PRND_MOUSE Q9QUG3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QUG3
Recommended name：Prion-like protein doppel
EC number：
Alternative names：(Doppelganger) (Dpl) (PrPLP)
Cleaved into：
GeneID：26434
Gene names (primary )：Prnd
Gene names (synonym )：
Gene names (ORF )：
Length：179
Mass：20442
Sequence：MKNRLGTWWVAILCMLLASHLSTVKARGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERGAALRVAVDQPAMVCLLGFVWFIVK
Tissue specificity：Detected in testis (PubMed:10842180, PubMed:12110578, PubMed:15161660). Detected within seminiferous tubules, on round and elongated spermatids (at protein level) (PubMed:12110578). Not detected in brain (at protein level) (PubMed:10842180, PubMed:15161660). Detected in testis, and at low levels in heart (PubMed:10525406, PubMed:12110578). Expression in brain is very low and barely detectable (PubMed:10525406). {ECO:0000269|PubMed:10525406, ECO:0000269|PubMed:10842180, ECO:0000269|PubMed:12110578, ECO:0000269|PubMed:15161660}.
Induction：
Developmental stage：Expressed during embryogenesis. {ECO:0000269|PubMed:10525406}.
Protein families：Prion family