PIP_MOUSE   P02816


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P02816

Recommended name:Prolactin-inducible protein homolog

EC number:

Alternative names:(14 kDa submandibular gland protein) (SMGP) (Gross cystic disease fluid protein 15) (GCDFP-15) (Prolactin-induced protein)

Cleaved into:

GeneID:18716

Gene names  (primary ):Pip

Gene names  (synonym ):

Gene names  (ORF ):

Length:146

Mass:16823

Sequence:MQGLSFTFSAVTLFLVLCLQLGIIESQDDENVRKPLLIEIDVPSTAQENQEITVQVTVETQYRECMVIKAYLVSNEPMEGAFNYVQTRCLCNDHPIRFFWDIIITRTVTFATVIDIVREKNICPNDMAVVPITANRYYTYNTVRMN

Tissue specificity:Lacrimal and submaxillary glands.

Induction:

Developmental stage:

Protein families:PIP family


   💬 WhatsApp