DYL1_RAT P63170
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63170
Recommended name：Dynein light chain 1, cytoplasmic
EC number：
Alternative names：
Cleaved into：
GeneID：58945
Gene names (primary )：Dynll1
Gene names (synonym )：Dncl1, Dnclc1, Pin
Gene names (ORF )：
Length：89
Mass：10,366
Sequence：MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Tissue specificity：Weaker expression in the cerebellum and spinal cord compared with other brain regions.
Induction：
Developmental stage：
Protein families：