CATS_RAT   Q02765


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q02765

Recommended name:Cathepsin S

EC number:EC:3.4.22.27

Alternative names:

Cleaved into:

GeneID:50654

Gene names  (primary ):Ctss

Gene names  (synonym ):

Gene names  (ORF ):

Length:330

Mass:36,833

Sequence:MAVLGAPGVLCDNGATAERPTLDHHWDLWKKTRMRRNTDQNEEDVRRLIWEKNLKFIMLHNLEHSMGMHSYSVGMNHMGDMTPEEVIGYMGSLRIPRPWNRSGTLKSSSNQTLPDSVDWREKGCVTNVKYQGSCGSCWAFSAEGALEGQLKLKTGKLVSLSAQNLVDCSTEEKYGNKGCGGGFMTEAFQYIIDTSIDSEASYPYKAMDEKCLYDPKNRAATCSRYIELPFGDEEALKEAVATKGPVSVGIDDASHSSFFLYQSGVYDDPSCTENMNHGVLVVGYGTLDGKDYWLVKNSWGLHFGDQGYIRMARNNKNHCGIASYCSYPEI

Tissue specificity:Highest levels occur in the ileum followed by spleen, brain, thyroid, ovary and uterus. Low levels are found in the liver, kidney, jejunum and lung with lowest levels in the heart.

Induction:

Developmental stage:By thyroid-stimulating hormone.

Protein families:


   💬 WhatsApp