GOLI4_RAT   Q5BJK8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5BJK8

Recommended name:Golgi integral membrane protein 4

EC number:

Alternative names:

Cleaved into:

GeneID:310526

Gene names  (primary ):Golim4

Gene names  (synonym ):Gimpc, Golph4

Gene names  (ORF ):

Length:653

Mass:76,597

Sequence:MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYLELQTQLRKAEAVALKYQQHQDSLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGRQDSNSRYSALNVQHQMLKSQHEELRKQHSDLEEEHRKQGEDFSRAFNDHKQRYLQLQQEKEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKTQVAEYKQLKDTLNRIPSFRNPDPAEQQNVTFTHGTHPPQGYNVREKLTGELQEGQQNHDAMPRRMEEKPLSSMQKEAGFQALEEQNQVEPREPEGRQVEEEHRKALEEEEMEQVGQAEHLEEEHDPSPEEQDREWRDQRRQNAAHLLDGRPQAEIEHSTKAATNFRSPYEEQLEQQRLAARRDEEAQRLREHQEALHQQRLHGQLLRQQQQQQYLAREMAQQKQADHEEGQQQYQLRQQAHSDAVENDVAQGAEDQGIPEEEGGAYDRDNQRQDEAEGDPGNRQEFHEPGHQEGDPEAEADRAAAQDINPADDPNNQGEDEFEEAEQVREENLPEESEERKQSEAKQGNVEMDEHLVMAGNPDQQEDNVDEQYQEEGEEEVQEDLTEEKKRELEHNAEETYGENPDDKNNDVEEQGVPNRAHPKGRQEHYEEEEDEEDGAAVAEKSHRRAEM

Tissue specificity:Expressed in liver, pancreas and pituitary (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp