GLT13_RAT   Q6UE39


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6UE39

Recommended name:Polypeptide N-acetylgalactosaminyltransferase 13

EC number:EC:2.4.1.41

Alternative names:Polypeptide GalNAc transferase 13 (GalNAc-T13; pp-GaNTase 13) Protein-UDP acetylgalactosaminyltransferase 13 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13

Cleaved into:

GeneID:311039

Gene names  (primary ):Galnt13

Gene names  (synonym ):

Gene names  (ORF ):

Length:556

Mass:63,949

Sequence:MRRLVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLSGPVIMLKCHHMRGNQLWEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGT

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp