B3GT4_MOUSE Q9Z0F0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0F0
Recommended name：Beta-1,3-galactosyltransferase 4
EC number：EC 2.4.1.62
Alternative names：(Beta-1,3-GalTase 4) (Beta3Gal-T4) (Beta3GalT4) (b3Gal-T4) (Gal-T2) (Ganglioside galactosyltransferase) (UDP-galactose:beta-N-acetyl-galactosamine-beta-1,3-galactosyltransferase)
Cleaved into：
GeneID：54218
Gene names (primary )：B3galt4
Gene names (synonym )：
Gene names (ORF )：
Length：371
Mass：41236
Sequence：MPLSLFRRVLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLISNSHACGGSGPPPFLLILVCTAPEHLNQRNAIRASWGAIREARGFRVQTLFLLGKPRRQQLADLSSESAAHRDILQASFQDSYRNLTLKTLSGLNWVNKYCPMARYILKTDDDVYVNVPELVSELIQRGGPSEQWQKGKEAQEETTAIHEEHRGQAVPLLYLGRVHWRVRPTRTPESRHHVSEELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPPLPLEDVFVGVSARRGGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKVDPWQMQEAWKLVSGMNGERTAPFCSWLQGFLGTLRCRFIAWFSS
Tissue specificity：Expressed in heart, brain, spleen, kidney, lung and testis. {ECO:0000269|PubMed:10502288}.
Induction：
Developmental stage：First expressed at embryonic day 3. Maintained at high levels between days 4 and 7 and declines thereafter to stabilize at low levels after day 10. {ECO:0000269|PubMed:10502288}.
Protein families：Glycosyltransferase 31 family