CEBPD_RAT   Q03484


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q03484

Recommended name:CCAAT/enhancer-binding protein delta

EC number:

Alternative names:Transcription factor CELF

Cleaved into:

GeneID:25695

Gene names  (primary ):Cebpd

Gene names  (synonym ):Celf

Gene names  (ORF ):

Length:268

Mass:28,600

Sequence:MSAALFSLDSPARGAPWPTEPAAFYEPGRVGKPGRGPEPGDLGEPGSTTPAMYDDESAIDFSAYIDSMAAVPTLELCHDEIFADLFNSNHKAAGAGSLELLQGGPTRPPGVGSIARGPLKREPDWGDGDAPGSLLPAQVAVCAQTVVSLAAAAQPTPPTSPEPPRGSPGPSLAPGPVREKGAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLASLRQFFKELPSPPFLPPTGTDCR

Tissue specificity:Ubiquitously expressed. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp