BTG3_RAT O88677
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88677
Recommended name：Protein BTG3
EC number：
Alternative names：BTG family member 3
Cleaved into：
GeneID：54230
Gene names (primary )：Btg3
Gene names (synonym )：
Gene names (ORF )：
Length：252
Mass：28,914
Sequence：MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTQILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDPDVLKACEDSCILYSDLGLPKELTLWVDPCEVCCRYGKKNNAFIVASFENEDENKDEISKKVSRALDKVTSDYHSGSSSSDEDTSKEVEVKPSAVATTPSPVYQISELIFPPLPMWHPLPRKKPGMYRGGGHQSHYPPPVPFAYPSPGRKNKAFRPIPVTWVPPPGMHCDRNHWINPHMLAPH
Tissue specificity：Highly expressed in the brain. 1
Induction：
Developmental stage：By 12-O-tetradecanoylphorbol-13-acetate (TPA). Induced at higher levels by TPA and cycloheximide together. Also induced by redox changes after stimulation by hydrogen peroxide or menadione. 1
Protein families：