SMR1_RAT P13432
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P13432
Recommended name：SMR1 protein
EC number：
Alternative names：SMR1-related undecapeptide SMR1-related hexapeptide Sialorphin Alternative names: SMR1-related pentapeptide Submandibular gland peptide T (SGP-T)
Cleaved into：
GeneID：24867
Gene names (primary )：Vcsa1
Gene names (synonym )：Smr1
Gene names (ORF )：
Length：146
Mass：15,970
Sequence：MKSLYLIFGLWILLACFQSGEGVRGPRRQHNPRRQQDPSTLPHYLGLQPDPNGGQIGVTITIPLNLQPPRVLVNLPGFITGPPLVVQGTTEYQYQWQLTAPDPTPLSNPPTQLHSTEQANTKTDAKISNTTATTQNSTDIFEGGGK
Tissue specificity：Expressed predominantly in the acinar cells of the submandibular gland and to lesser extent in the prostate.
Induction：
Developmental stage：By androgens; strongly.
Protein families：