SBP1_RAT   Q8VIF7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VIF7

Recommended name:Methanethiol oxidase By Similarity

EC number:EC:1.8.3.4

Alternative names:MTO By Similarity

Cleaved into:

GeneID:103689947

Gene names  (primary ):Selenbp1

Gene names  (synonym ):Sbp

Gene names  (ORF ):

Length:472

Mass:52,532

Sequence:MATKCTKCGPGYATPLEAMKGPREEIVYLPCIYRNTGIEAPDYLATVDVDPKSPHYSQVIHRLPMPHLKDELHHSGWNTCSSCFGDSTKSRDKLILPSIISSRIYVVDVGSEPRAPKLHKVIEPNEIHAKCNLGNLHTSHCLASGEVMISSLGDPQGNGKGGFVLLDGETFEVKGTWEKPGGEAPMGYDFWYQPRHNIMVSTEWAAPNVFKDGFNPAHVEAGLYGSHIHVWDWQRHEIIQTLQMKDGLIPLEIRFLHDPDATQGFVGCALSSNIQRFYKNEGGTWSVEKVIQVPSKKVKGWMLPEMPGLITDILLSLDDRFLYFSNWLHGDIRQYDISNPKKPRLTGQIFLGGSIVKGGSVQVLEDQELTCQPEPLVVKGKRVPGGPQMIQLSLDGKRLYVTTSLYSAWDKQFYPNLIREGSVMLQIDVDTANGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI

Tissue specificity:Present in liver and colon (at protein level). 1

Induction:

Developmental stage:In liver, by 3,4,5,3',4'-pentachlorobiphenyl and 3-methylcholanthrene (at protein level). 1

Protein families:


   💬 WhatsApp