RHES_RAT   P63033


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63033

Recommended name:GTP-binding protein Rhes

EC number:

Alternative names:

Cleaved into:

GeneID:171099

Gene names  (primary ):Rasd2

Gene names  (synonym ):

Gene names  (ORF ):

Length:266

Mass:30,197

Sequence:MMKTLSSGNCTLNVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAMEAELLVSGDENCAYFEVSAKKNTNVNEMFYVLFSMAKLPHEMSPALHHKISVQYGDAFHPRPFCMRRTKVAGAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCSIQ

Tissue specificity:Prominently expressed in the striatum, weakly in the cerebral cortex and the CA fields of the hippocampus. Highly expressed in the hippocampus and cerebellum, only during the postnatal period. Also expressed in pancreatic endocrine cells (islets of Langerhans), adrenal gland and stomach and in a thyroid cell line. 5 s

Induction:Low levels detected at 16 dpc through P10, and increased between P10 and P15 during the development of brain; the amount did decrease in the adult brain.

Developmental stage:By thyroid hormone, efaroxan and glibenclamide. 2 s

Protein families:


   💬 WhatsApp