ANGL4_MOUSE   Q9Z1P8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z1P8

Recommended name:Angiopoietin-related protein 4

EC number:

Alternative names:(425O18-1) (Angiopoietin-like protein 4) (Fasting-induced adipose factor) (Hepatic fibrinogen/angiopoietin-related protein) (HFARP) (Secreted protein Bk89)

Cleaved into:ANGPTL4 N-terminal chain; ANGPTL4 C-terminal chain

GeneID:57875

Gene names  (primary ):Angptl4

Gene names  (synonym ):Farp Fiaf Ng27

Gene names  (ORF ):

Length:410

Mass:45538

Sequence:MRCAPTAGAALVLCAATAGLLSAQGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

Tissue specificity:Detected in liver and kidney (PubMed:10698685, PubMed:17609370). Predominantly expressed in adipose tissue and is strongly up-regulated by fasting in white adipose tissue and liver. {ECO:0000269|PubMed:10698685, ECO:0000269|PubMed:10862772, ECO:0000269|PubMed:17609370}.

Induction:Induced in interstitial capillaries in response to hind leg ischemia (PubMed:17068295). Alterations in nutrition and leptin administration are found to modulate the expression in vivo. {ECO:0000269|PubMed:10866690, ECO:0000269|PubMed:17068295}.

Developmental stage:Detected in endothelial cells in the capillary plexus, veins and arteries in the retina at 2, 12 and 17 days after birth (PubMed:21832056). Expressed at low levels in most organs and connective tissue at 13.5 dpc. Between 15.5 dpc and 18.5 dpc, strongest expression in brown fat. {ECO:0000269|PubMed:10866690, ECO:0000269|PubMed:21832056}.

Protein families:


   💬 WhatsApp