ESP22_MOUSE   A8R0V4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A8R0V4

Recommended name:Exocrine gland-secreted peptide 22

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Esp22

Gene names  (synonym ):

Gene names  (ORF ):

Length:111

Mass:12570

Sequence:MNSVPVMLFSISILLAAMLTEGRGLTQTQKESIFSAEHKSDLKSYLEMLVCRRLRDVPESVIHISKVSKEILPDDLLSTYLLELLVCFDKDKLVQSKGIVFNTIKRLLTNT

Tissue specificity:Expressed in acinar cells of the lacrimal gland from where it is secreted into tears. Not detected in a range of other tissues tested including other exocrine glands, internal organs and sensory epithelia. {ECO:0000269|PubMed:24089208}.

Induction:

Developmental stage:Expressed maximally between 2 and 3 weeks of age. Levels decrease sharply after 4 weeks around puberty. Expression is 50-fold higher in juveniles than adults with similar levels in male and female juveniles. Not expressed in castrated or ovariectomized adults. {ECO:0000269|PubMed:24089208}.

Protein families:Exocrine gland-secreted peptide family


   💬 WhatsApp