INKA2_MOUSE Q80VY2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80VY2
Recommended name：PAK4-inhibitor INKA2
EC number：
Alternative names：(Induced in neural crest by AP2-alpha protein-related homolog) (MInca-r)
Cleaved into：
GeneID：109050
Gene names (primary )：Inka2
Gene names (synonym )：Fam212b
Gene names (ORF )：
Length：300
Mass：33233
Sequence：MTKESKDMDCYLRRLKQELMSMKEVGDGLQDQMNCMMGALQELKLLQVQTALEQLEISGGTPTFSCPESSQEQPECPRWQGSGGPAGPAAWTSSSQPSFDSSPKLPCRRSVCGKELAVLPKTQLPEEHQSCTQQGTEWVEPDDWTSTLMSRGRNRQPLVLGDNVFADLVGNWLDLPELEKGGEKGETGGSIEPKGEKGQSRELGRKFALTANIFRKFLRSVRPDRDRLLKEKPGWMTPMVSESRAGRSKKVKKRSLSKGSGRFPFSSTGEPRHIETPATSSPKALEPSCRGFDINTAVWV
Tissue specificity：Enriched in the nervous system. {ECO:0000269|PubMed:26292052}.
Induction：
Developmental stage：During development, expressed in oligodendrocyte progenitor cells and in the proliferative neuronal progenitors in the developing cerebellum. In the embryonic brain, not expressed in immature newborn neurons, except for the cells residing in the marginal zone of the embryonic telencephalon. As brain development proceeds during the postnatal stage, expressed in some populations of immature neurons, including the neocortical pyramidal neurons, hippocampal pyramidal neurons and granule cells migrating in the cerebellar cortex. In the adult brain, expression is confined in terminally differentiated neurons in the restricted forebrain regions. {ECO:0000269|PubMed:26292052}.
Protein families：INKA family