PCP4_MOUSE   P63054


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63054

Recommended name:Calmodulin regulator protein PCP4

EC number:

Alternative names:(Brain-specific antigen PCP-4) (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4)

Cleaved into:

GeneID:18546

Gene names  (primary ):Pcp4

Gene names  (synonym ):Pep19

Gene names  (ORF ):

Length:62

Mass:6807

Sequence:MSERQSAGATNGKDKTSGDNDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS

Tissue specificity:

Induction:

Developmental stage:

Protein families:PCP4 family


   💬 WhatsApp