CLC4E_MOUSE Q9R0Q8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R0Q8
Recommended name：C-type lectin domain family 4 member E
EC number：
Alternative names：(C-type lectin superfamily member 9) (Macrophage-inducible C-type lectin) (Mincle)
Cleaved into：
GeneID：56619
Gene names (primary )：Clec4e
Gene names (synonym )：Clecsf9 Mincle
Gene names (ORF )：
Length：214
Mass：24431
Sequence：MNSTKSPASHHTERGCFKNSQVLSWTIAGASILFLSGCFITRCVVTYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD
Tissue specificity：Highly expressed in macrophages in response to stimulation with bacterial glycolipids and proinflammatory cytokines (PubMed:10528209). Expressed in dendritic cells (at protein level) in response to stimulation with mycobacterial trehalose 6,6'-dimycolate (TDM) (PubMed:23602766). {ECO:0000269|PubMed:10528209, ECO:0000269|PubMed:23602766}.
Induction：Expression is induced upon exposure to bacterial glycolipids including lipopolysaccharide (LPS) and mycobacterial trehalose 6,6'-dimycolate (TDM) and several proinflammatory cytokines, including IFNG and TNF (PubMed:10528209, PubMed:23602766). Rapidly induced in thymus in response to whole-body irradiation and excessive cell death (PubMed:18776906). {ECO:0000269|PubMed:10528209, ECO:0000269|PubMed:18776906, ECO:0000269|PubMed:23602766}.
Developmental stage：
Protein families：