WFD21_MOUSE   Q8BTE6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BTE6

Recommended name:Protein Wfdc21

EC number:

Alternative names:(Wdnm1-like protein)

Cleaved into:

GeneID:66107

Gene names  (primary ):Wfdc21

Gene names  (synonym ):Wdnml1

Gene names  (ORF ):

Length:63

Mass:6792

Sequence:MKLGAFLLLVSLITLSLEVQELQAAVRPLQLLGTCAELCRGDWDCGPEEQCVSIGCSHICTTN

Tissue specificity:Predominantly expressed in white adipose tissue and liver. {ECO:0000269|PubMed:18492766}.

Induction:Up-regulated by TNF-alpha and lipopolysaccharide (LPS) in vitro. {ECO:0000269|PubMed:18492766}.

Developmental stage:

Protein families:


   💬 WhatsApp