SRPX_RAT   Q63769


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q63769

Recommended name:Sushi repeat-containing protein SRPX

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Srpx

Gene names  (synonym ):Drs

Gene names  (ORF ):

Length:464

Mass:51,560

Sequence:MGSPGLRPTLLLPQVLLLLLALLHVPPSQGFPGSGDSPLEDDGVWSSHSLYKDTPWCSPIKVKYGDVYCRAPPGGYYKTALGTRCDIRCRKGYELHGSSQLVCQSNRRWSDKVICKQKRCPTLTMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILRGLPPGSNFPEGDHKIEYTVYDRAENKGTCKFRVKVRVRRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPSCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIRAKIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKERYVSLVTPMALFNLIDTFPLRKEEMILQAEMGQSCNT

Tissue specificity:Normal cells and cells transformed by human papillomavirus type 16 E6E7 and polyomavirus large T. Suppressed in cells transformed by oncogenes such as V-SRC, V-ABL, V-FPS, V-MOS, V-SIS, V-K-RAS, and polyomavirus middle T.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp