ACTH_MOUSE   P63268


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63268

Recommended name:Actin, gamma-enteric smooth muscle

EC number:

Alternative names:(Alpha-actin-3) (Gamma-2-actin) (Smooth muscle gamma-actin)

Cleaved into:Actin, gamma-enteric smooth muscle, intermediate form

GeneID:11468

Gene names  (primary ):Actg2

Gene names  (synonym ):Acta3 Actsg

Gene names  (ORF ):

Length:376

Mass:41877

Sequence:MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF

Tissue specificity:Expressed in tissues containing smooth muscle particularly the intestines and bladder. {ECO:0000269|PubMed:24337657}.

Induction:

Developmental stage:

Protein families:Actin family


   💬 WhatsApp