IRF1_MOUSE   P15314


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P15314

Recommended name:Interferon regulatory factor 1

EC number:

Alternative names:(IRF-1)

Cleaved into:

GeneID:16362

Gene names  (primary ):Irf1

Gene names  (synonym ):

Gene names  (ORF ):

Length:329

Mass:37319

Sequence:MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQRKERKSKSSRDTKSKTKRKLCGDVSPDTFSDGLSSSTLPDDHSSYTTQGYLGQDLDMERDITPALSPCVVSSSLSEWHMQMDIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPTHIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMKNMDSIMWMDSLLGNSVRLPPSIQAIPCAP

Tissue specificity:

Induction:Induced by IFN-gamma (PubMed:17018642, PubMed:18955028, PubMed:29321274). Induced by influenza A virus (PubMed:29321274). {ECO:0000269|PubMed:17018642, ECO:0000269|PubMed:18955028, ECO:0000269|PubMed:29321274}.

Developmental stage:

Protein families:IRF family


   💬 WhatsApp