FGF16_RAT   O54769


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O54769

Recommended name:Fibroblast growth factor 16

EC number:

Alternative names:

Cleaved into:

GeneID:60464

Gene names  (primary ):Fgf16

Gene names  (synonym ):

Gene names  (ORF ):

Length:207

Mass:23,753

Sequence:MAEVGGVFASLDWDLQGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELFGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFRYR

Tissue specificity:In adult, predominantly expressed in heart, in the cardiac myocytes. Not detected in brain, lung, liver, kidney and white adipose tissue. In embryos, predominantly expressed in the brown adipose tissue. 1

Induction:

Developmental stage:Expression in brown adipose tissue decreased greatly after birth. 1

Protein families:


   💬 WhatsApp