H2B1A_MOUSE P70696
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70696
Recommended name：Histone H2B type 1-A
EC number：
Alternative names：(Histone H2B, testis) (Testis-specific histone H2B)
Cleaved into：
GeneID：319177
Gene names (primary )：H2bc1
Gene names (synonym )：Hist1h2ba Th2b
Gene names (ORF )：
Length：127
Mass：14237
Sequence：MPEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Tissue specificity：Mainly expressed in testis, and the corresponding protein is also present in mature sperm. Also present in metaphase oocytes (at protein level). {ECO:0000269|PubMed:23884607, ECO:0000269|PubMed:8672246}.
Induction：
Developmental stage：Accumulates at 10 day postpartum (dpp), when pre-leptotene/leptotene spermatocytes first appear and when H2B expression shows a drastic decrease. Replaces H2B by 18 dpp in spermatocytes. Also present in metaphase oocytes and in the female pronucleus at fertilization and is also rapidly incorporated into the male pronucleus. {ECO:0000269|PubMed:23884607}.
Protein families：Histone H2B family