RAB7L_RAT Q63481
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63481
Recommended name：Ras-related protein Rab-7L1
EC number：
Alternative names：
Cleaved into：
GeneID：171122
Gene names (primary )：Rab29
Gene names (synonym )：Rab7l1
Gene names (ORF )：
Length：204
Mass：23,117
Sequence：MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSREDIMSSSTQGNYINLQTKPSPGWTCC
Tissue specificity：Expressed predominantly in kidney and much less in brain, heart, muscle, fat, liver, spleen, adrenal gland, ovary, thymus and lung. Not expressed in testis and intestine. 1
Induction：
Developmental stage：
Protein families：