SG3A1_MOUSE Q920D7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920D7
Recommended name:Secretoglobin family 3A member 1
EC number:
Alternative names:(Cytokine HIN-1) (High in normal 1) (Pneumo secretory protein 2) (PnSP-2) (Uteroglobin-related protein 2)
Cleaved into:
GeneID:68662
Gene names (primary ):Scgb3a1
Gene names (synonym ):Hin1 Pnsp2 Ugrp2
Gene names (ORF ):
Length:104
Mass:10591
Sequence:MKLTTTFLVLCVALLSDSGVAFFMDSLAKPAVEPVAALAPAAEAVAGAVPSLPLSHLAILRFILASMGIPLDPLIEGSRKCVTELGPEAVGAVKSLLGVLTMFG
Tissue specificity:Highly expressed in lung, where it localizes to epithelial cells lining the trachea and bronchi (PubMed:12406855, PubMed:12175512). Expression in lung is mainly restricted to bronchi, submucosal glands of the trachea, and tracheal epithelium, with little expression in terminal bronchioles (PubMed:12406855). Expressed in uterus where it localizes to epithelial cells of the uterine glands (PubMed:12175512). Also detected in heart, stomach and small intestine (PubMed:12175512). {ECO:0000269|PubMed:12175512, ECO:0000269|PubMed:12406855}.
Induction:
Developmental stage:Detected in lung at embryonic stage 18.5 dpc. During gestation, expressed in the mammary gland from 6.5 dpc with highest expression at 10.5 dpc. Expression then declines, but later increases again during mammary gland involution at 4-21 days post partum. {ECO:0000269|PubMed:12175512}.
Protein families:Secretoglobin family, UGRP subfamily