APOC3_MOUSE   P33622


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P33622

Recommended name:Apolipoprotein C-III

EC number:

Alternative names:(Apo-CIII) (ApoC-III) (Apolipoprotein C3)

Cleaved into:

GeneID:11814

Gene names  (primary ):Apoc3

Gene names  (synonym ):

Gene names  (ORF ):

Length:99

Mass:10982

Sequence:MQPRTLLTVALLALLASARAEEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES

Tissue specificity:

Induction:

Developmental stage:

Protein families:Apolipoprotein C3 family


   💬 WhatsApp