CCL2_MOUSE P10148
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P10148
Recommended name：C-C motif chemokine 2
EC number：
Alternative names：(Monocyte chemoattractant protein 1) (Monocyte chemotactic protein 1) (MCP-1) (Platelet-derived growth factor-inducible protein JE) (Small-inducible cytokine A2)
Cleaved into：
GeneID：20296
Gene names (primary )：Ccl2
Gene names (synonym )：Je Mcp1 Scya2
Gene names (ORF )：
Length：148
Mass：16326
Sequence：MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
Tissue specificity：
Induction：By platelet-derived growth factor (PubMed:23233732). Up-regulated upon hypertonic conditions (PubMed:23233732). Up-regulated in the dopamine D1 and D2 receptor-containing neurons of nucleus accumbens shell after spinal nerve ligation (PubMed:29993042). {ECO:0000269|PubMed:23233732, ECO:0000269|PubMed:29993042}.
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family