GPR3_RAT   Q8K1Q3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K1Q3

Recommended name:G-protein coupled receptor 3

EC number:

Alternative names:

Cleaved into:

GeneID:266769

Gene names  (primary ):Gpr3

Gene names  (synonym ):

Gene names  (ORF ):

Length:329

Mass:35,327

Sequence:MMWGAGRSMAWFSAGSGSVNVSIDPAEEPTGPATLLPSPRAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAADFCIGSPEMSLVLVGVLATAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWVGALGLGLVPVLAWNCRDGLTTCGVVYPLSKNHLVVLAIVFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDANSPPLYTYLTLLPATYNSMINPVIYAFRNQDVQKVLWAICCCCSTSKIPFRSRSPSDV

Tissue specificity:Abundantly expressed in granule neurons at all development stages. Enriched in the longest tips of neurites during differentiation of hippocampal neurons. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp