SYUG_MOUSE Q9Z0F7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0F7
Recommended name：Gamma-synuclein
EC number：
Alternative names：(Persyn)
Cleaved into：
GeneID：20618
Gene names (primary )：Sncg
Gene names (synonym )：Persyn
Gene names (ORF )：
Length：123
Mass：13160
Sequence：MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEEAKSGED
Tissue specificity：Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung. Expressed predominantly in the cell bodies and axons of primary sensory neurons, sympathetic neurons and motoneurons.
Induction：
Developmental stage：Developmentally expressed in primary sensory neurons and motoneurons. In trigeminal ganglia, expression increases between embryonic day 10 and day 12. High levels are maintained here throughout later stages of development and in adulthood.
Protein families：Synuclein family