DMRTC_MOUSE   Q9D9R7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D9R7

Recommended name:Doublesex- and mab-3-related transcription factor C1

EC number:

Alternative names:(Doublesex- and mab-3-related transcription factor 8.1)

Cleaved into:

GeneID:70887

Gene names  (primary ):Dmrtc1

Gene names  (synonym ):Dmrt8.1 Dmrtc1a

Gene names  (ORF ):

Length:182

Mass:19230

Sequence:MVEEEVAKKYDSSFTAGKNTVQQIQAQVDTATQEESSQGPVLLNQHPETTSVPYTPETVGQQLMVSLPGEPHGTSAMPSMCPSLILQPCATTDPMLLQPQVMGPSASNQASVSATLEWQEMLEAAEALLALKNSSQTRHQPCGMPGTAGERGLQLANPSMPPRPTSSGSLPSGHLDCMSLLT

Tissue specificity:Expressed in Sertoli cells in male testis. {ECO:0000269|PubMed:16488114}.

Induction:

Developmental stage:Detected in many tissues at 13.5 dpc.

Protein families:DMRT family


   💬 WhatsApp