HMR1_RAT O19477
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O19477
Recommended name:Major histocompatibility complex class I-related gene protein
EC number:
Alternative names:
Cleaved into:
GeneID:25119
Gene names (primary ):Mr1
Gene names (synonym ):Hlals
Gene names (ORF ):
Length:343
Mass:39,571
Sequence:MMFLLPFLTVFLAKQSHTRTHSLRYFRLAISDPGPGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQRTFQTELRHLQRHYNHSGLHTYQRMIGCELLEDGSTTGFLQYAYDGQDFIVFDKDTLSWLAMDNVAHITKRAWEANLHELQYQKNWLEEECIAWLKRFLEYGSDALERTEHPVVRTTRKETFPGITTLFCRAHGFYPPEISMIWKKNGEEIVQEVDYGGVLPSGDGTYQMWVSVDLDPQTKDIYSCHVEHCGLQMVLEAPQESGNTLLVANTISGTIILIIVLAGVGALIWRRRSREPKEVMYQPTQVNEGSSPS
Tissue specificity:Expressed in kidney, liver, testis, spleen, thymus, brain, and heart. 1
Induction:
Developmental stage:
Protein families: