TEX24_MOUSE Q5DP50
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5DP50
Recommended name：Protein Tex24
EC number：
Alternative names：(Testis-expressed protein 24) (Testis-specific factor 1)
Cleaved into：
GeneID：541463
Gene names (primary )：Tex24
Gene names (synonym )：TESF-1
Gene names (ORF )：
Length：351
Mass：38993
Sequence：MGSQSLNSTFLKVRRLSLISSNERLLGQTSGLATGSRLVTQEVDDLRVIPGSRPDLDDHQPQCSLAELPSTAHGKRKPGHLPRLRSSAVKGHAPDPNPSLSIVSKRIFKGESVIKGPEDRQTFVGPSGLPKISPKATAGEAQGKKRTMELLNKARKQEEKVSNLLDIRQLPKQEVFINNTHPCKKHLKQQPMSLEEWRRGHLGGDNTGLISQEPFRCCKRLGKKAQCQLLEVTSLEAEASLEVLKRRRRMQAMEMSKKPQDRGLGQEKAVFLSREKVKPSSHDMHLSTAERSFKPKSMPKAEDWDLSVQGTPVVLTVRDHSNVSQAQKHLGCAEIFHSRDGRCTLLKRGGA
Tissue specificity：Specific to testis, where it is expressed in spermatogonia. {ECO:0000269|PubMed:16343427}.
Induction：
Developmental stage：Detected in testis from postnatal day 20 onwards. {ECO:0000269|PubMed:16343427}.
Protein families：