ISK1L_RAT P09656
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P09656
Recommended name：Serine protease inhibitor Kazal-type 1-like Imported
EC number：
Alternative names：
Cleaved into：
GeneID：266602
Gene names (primary )：Spink1l
Gene names (synonym )：Spink3 Imported
Gene names (ORF )：
Length：79
Mass：8,565
Sequence：MKVAIIFLLSALALLNLAGNTTAKVIGKKANCPNTLVGCPRDYDPVCGTDGKTYANECILCFENRKFGTSIRIQRRGLC
Tissue specificity：Seminal vesicle. 1
Induction：
Developmental stage：
Protein families：