CP4F6_RAT P51871
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51871
Recommended name：Cytochrome P450 4F6
EC number：EC:1.14.14.1
Alternative names：CYPIVF6
Cleaved into：
GeneID：266689
Gene names (primary )：Cyp4f6
Gene names (synonym )：
Gene names (ORF )：
Length：537
Mass：61,541
Sequence：MLQLSLSRLGMGSLTASPWHLLLLGGASWILARILAWIYTFYDNCCRLRCFPQPPKPSWFWGHLTLMKNNEEGMQFIAHLGRNFRDIHLSWVGPVYPILRLVHPNVIAPLLQASAAVAPKEMTLYGFLKPWLGDGLLMSAGEKWNHHRRLLTPAFHFDILKSYVKIFNKSVNTMHAKWQRLTAKGSARLDMFEHISLMTLDSLQKCIFSFDSNCQESNSEYIAAILELSSLIVKRQRQPFLYLDFLYYLTADGRRFRKACDVVHNFTDAVIRERRSTLNTQGVDEFLKARAKTKTLDFIDVLLLAKDEHGKGLSDVDIRAEADTFMFGGHDTTASALSWILYNLARHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPVLLISRCCSQDIVLPDGRVIPKGNICVISIFGVHHNPSVWPDPEVYNPFRFDPENPQKRSPLAFIPFSAGPRNCIGQTFAMSEIKVALALTLLRFCVLPDDKEPRRKPELILRAEGGLWLRVEPLSTVTSQLPWDLLAHPPTS
Tissue specificity：High expression in liver and kidney. Lower expression in brain.
Induction：
Developmental stage：
Protein families：