RNS10_MOUSE   Q9D5A9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D5A9

Recommended name:Inactive ribonuclease-like protein 10

EC number:

Alternative names:(Protein Train A)

Cleaved into:

GeneID:75019

Gene names  (primary ):Rnase10

Gene names  (synonym ):

Gene names  (ORF ):

Length:208

Mass:23407

Sequence:MKVTLVHLLFMMLLLLLGLGLGLGLGLHMAAAVLEDQPLNEFWPSDSQNTEEGEGIWTTEGLALGYKEMAQPVWPEEAVLSEDEVGGSRMLRAEPRFQSKQDYLKFDLSVRDCNTMMAHKIKEPNQSCINQYTFIHEDPNTVKAVCNGSLVDCDLQGGKCYKSPRPFDLTLCKLAKPGQVTPNCHYLTYITEKSIFMTCNDKRQLETK

Tissue specificity:Male-specific expression in proximal caput of the epididymis (at protein level). {ECO:0000269|PubMed:12920233, ECO:0000269|PubMed:14561640, ECO:0000269|PubMed:22750516}.

Induction:

Developmental stage:Expressed in mature epididymis. {ECO:0000269|PubMed:12920233}.

Protein families:Pancreatic ribonuclease family


   💬 WhatsApp