NRARP_MOUSE Q91ZA8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91ZA8
Recommended name：Notch-regulated ankyrin repeat-containing protein
EC number：
Alternative names：
Cleaved into：
GeneID：67122
Gene names (primary )：Nrarp
Gene names (synonym )：
Gene names (ORF )：
Length：114
Mass：12492
Sequence：MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR
Tissue specificity：Expressed at high levels in the brain, heart, colon, kidney, liver, lung and small intestine. Expressed in retina, most prominent in endothelial cells at the migrating point of the vasculature behind leading tip cells. Expressed in testis. {ECO:0000269|PubMed:11783997, ECO:0000269|PubMed:19154719, ECO:0000269|PubMed:24015274}.
Induction：By Notch signaling via a CBF1/Su(H)/Lag-1 (CSL)-dependent pathway. {ECO:0000269|PubMed:11783997}.
Developmental stage：During embryogenesis, expressed in several tissues in which cellular differentiation is regulated by the notch signaling pathway. At 10.5 dpc expressed in intersomatic vessels and in vessels of the limb buds with strongest expression at vascular branch points. Cyclic expression between 8.5 dpc and 10.5 dpc somitogenesis is dependent on DLL3. {ECO:0000269|PubMed:11783997, ECO:0000269|PubMed:19154719, ECO:0000269|PubMed:19268448}.
Protein families：NRARP family