PATE4_MOUSE   Q09098


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q09098

Recommended name:Prostate and testis expressed protein 4

EC number:

Alternative names:(Calcium transport inhibitor) (Caltrin) (PATE-like protein B) (PATE-B) (Seminal vesicle protein 7) (Seminal vesicle protein VII) (SVS VII)

Cleaved into:

GeneID:56872

Gene names  (primary ):Pate4

Gene names  (synonym ):Svs7

Gene names  (ORF ):

Length:99

Mass:11058

Sequence:MNSVTKISTLLIVILSFLCFVEGLICNSCEKSRDSRCTMSQSRCVAKPGESCSTVSHFVGTKHVYSKQMCSPQCKEKQLNTGKKLIYIMCCEKNLCNSF

Tissue specificity:Expressed in prostate, testis, eye, kidney and skeletal muscle. Expressed in the dorsal lobe of prostate. Not expressed in the ventral lobe of prostate. {ECO:0000269|PubMed:18387948}.

Induction:By castration in the ventral lobe of prostate. This induction is suppressed by subsequent dihydroxytestosterone administration.

Developmental stage:

Protein families:PATE family


   💬 WhatsApp