NFIP1_MOUSE Q8R0W6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R0W6
Recommended name：NEDD4 family-interacting protein 1
EC number：
Alternative names：(NEDD4 WW domain-binding protein 5)
Cleaved into：
GeneID：65113
Gene names (primary )：Ndfip1
Gene names (synonym )：N4wbp5
Gene names (ORF )：
Length：221
Mass：24914
Sequence：MALALAALAAVEPACGSGYQQLQNEEEPGEPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATIPLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY
Tissue specificity：Highly expressed in embryonic and early postnatal cortex (at protein level) (PubMed:23897647). Widely expressed (PubMed:11748237). Hardly detectable in resting T-cells; up-regulated in T-cells in response to activation (PubMed:17137798). {ECO:0000269|PubMed:11748237, ECO:0000269|PubMed:17137798, ECO:0000269|PubMed:23897647}.
Induction：Up-regulated after traumatic brain injury in surviving neurons around the lesion site. {ECO:0000269|PubMed:16822981}.
Developmental stage：
Protein families：