DTX1_MOUSE Q61010
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61010
Recommended name:E3 ubiquitin-protein ligase DTX1
EC number:EC 2.3.2.27
Alternative names:(FXI-T1) (Protein deltex-1) (Deltex1) (mDTX1) (RING-type E3 ubiquitin transferase DTX1)
Cleaved into:
GeneID:14357
Gene names (primary ):Dtx1
Gene names (synonym ):
Gene names (ORF ):
Length:627
Mass:68119
Sequence:MSRPGQGVMVPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPIAPAAPPAPPPPPPPLPPGGPPGALVVRPSATFAGAALWAAPATGPTEPAPPPGVPPRSPSAPNGAPTPGQNNLSRPGPQRSTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCLTRAPKPILHPPPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTICMERLVTASGYEGVLRNKSVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKAIYGEKTGTQPPGKMEFHLIPHSLPGFADTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPRHCYLPNNEKGRKVLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASYLDNVLAELTAQGVSEAMAKA
Tissue specificity:Predominantly expressed in the brain and testis. Weakly expressed in the thymus, spleen and ovary. Predominantly expressed in regions containing post-mitotic differentiating neurons. {ECO:0000269|PubMed:11226752, ECO:0000269|PubMed:11731257}.
Induction:
Developmental stage:In the CNS, it is expressed in the developing neural tube starting from 10.5 dpc in the spinal cord and around 11.5 dpc in the telencephalon. Expressed ubiquitously throughout the spinal cord and telencephalon during neurogenesis. Expressed throughout the developing retina from 12.5 to 15.5 dpc. Expressed in the developing thymus. Not expressed in the somite or presomite during somitogenesis. Expressed slightly later that Dtx2. {ECO:0000269|PubMed:11226752, ECO:0000269|PubMed:11731257}.
Protein families:Deltex family