ZPI_RAT Q62975
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62975
Recommended name：Protein Z-dependent protease inhibitor
EC number：
Alternative names：Regeneration-associated serpin 1 (RASP-1) Serpin A10
Cleaved into：
GeneID：171154
Gene names (primary )：Serpina10
Gene names (synonym )：Rasp1, Zpi
Gene names (ORF )：
Length：436
Mass：50,244
Sequence：MRVVSSLFLPVLLAEVWLVSSFNLSSHSPEAPIRLVSQDYENQTWEEYEWADPRDDNEYWLRASQQLSNETSSFGFSLLRKISMRHDGNVIFSPFGLSVAMVNLMLGAKGETKVQVENGLNLQALSQAGPLILPALFKRVKETFSSNKKLGLTQGSFAFIHKDFEIKKTYFNLSTMYFDTEYVPTNFRNSSQARGLMNHYINKETEGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPIFTEADTFHLDKYKAVKVPMMYREGNFASTFDKKFRCHILKLPYQGNATMLVVLMEKSGDHLALEDYLTTDLVEMWLQDMKTRKMEVFFPKFKLNQRYEMHELLKQVGIRRIFSTSADLSELSAVARNLQVSKVVQQSVLEVDERGTEVVSGTVSEITAYCMPPVIKVDRPFHFIIYEEMSQMLLFLGRVVNPTVL
Tissue specificity：Expressed by the liver and secreted in plasma. 1
Induction：
Developmental stage：In regenerating livers, it showed maximal expression 48 hours after hepatectomy, expression remaining elevated up to 2 weeks after liver removal. 1
Protein families：