BPNT1_RAT Q9Z1N4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z1N4
Recommended name：3'(2'),5'-bisphosphate nucleotidase 1 1 Publication
EC number：EC:3.1.3.7
Alternative names：3'-phosphoadenosine 5'-phosphate phosphatase 1 Publication (PAP phosphatase 1 Publication) Bisphosphate 3'-nucleotidase 1 (BPntase 1) Inositol-polyphosphate 1-phosphatase 1 Publication (EC:3.1.3.57 1 Publication) . EC:3.1.3.57 (UniProtKB | ENZYME | Rhea) 1 Publication RnPIP 2 Publications scHAL2 analogous 3
Cleaved into：
GeneID：64473
Gene names (primary )：Bpnt1
Gene names (synonym )：Sal3
Gene names (ORF )：
Length：308
Mass：33,174
Sequence：MASSHNVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPPGEVDQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAVLGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNKLVTDCIAAMNPDNVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNPLQYDKEVKHMNSAGVLAALRNYEYYASRVPESVKSALIP
Tissue specificity：Highly expressed in heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis. 1
Induction：
Developmental stage：
Protein families：