BPNT1_RAT   Q9Z1N4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z1N4

Recommended name:3'(2'),5'-bisphosphate nucleotidase 1 1 Publication

EC number:EC:3.1.3.7

Alternative names:3'-phosphoadenosine 5'-phosphate phosphatase 1 Publication (PAP phosphatase 1 Publication) Bisphosphate 3'-nucleotidase 1 (BPntase 1) Inositol-polyphosphate 1-phosphatase 1 Publication (EC:3.1.3.57 1 Publication) . EC:3.1.3.57 (UniProtKB | ENZYME | Rhea) 1 Publication RnPIP 2 Publications scHAL2 analogous 3

Cleaved into:

GeneID:64473

Gene names  (primary ):Bpnt1

Gene names  (synonym ):Sal3

Gene names  (ORF ):

Length:308

Mass:33,174

Sequence:MASSHNVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPPGEVDQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAVLGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNKLVTDCIAAMNPDNVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNPLQYDKEVKHMNSAGVLAALRNYEYYASRVPESVKSALIP

Tissue specificity:Highly expressed in heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp