GOPC_MOUSE   Q8BH60


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BH60

Recommended name:Golgi-associated PDZ and coiled-coil motif-containing protein

EC number:

Alternative names:(PDZ protein interacting specifically with TC10) (PIST)

Cleaved into:

GeneID:94221

Gene names  (primary ):Gopc

Gene names  (synonym ):

Gene names  (ORF ):

Length:463

Mass:50662

Sequence:MSAGGPCPAGAGGGPGGSSCPVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLEAQLVDLRSELTETQAEKVVLEKEVHEQLLQLHSTQLQLHAKTGQSVDSGAIKAKLSVHSVEDLERELEANKTEKVKEARLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGSGNSGASCKDSSGEMKMLQGYNKKAVRDAHENGDVGAAGESPLDDTAARAAHLHSLHQKKAY

Tissue specificity:Ubiquitously expressed (at protein level). Expressed in dorsal root glanglion (DRG), spinal chord and brain. Isoform 1 is preferentially expressed in whole brain (at protein level) and cerebellum. Expressed in spermatocytes and spermatides but not in Sertoli cells and spermatogonia. {ECO:0000269|PubMed:11384996, ECO:0000269|PubMed:12149515, ECO:0000269|PubMed:12372286, ECO:0000269|PubMed:15317815}.

Induction:

Developmental stage:In the cerebellum, expression increases post-natally, following maturation of this tissue (at protein level). {ECO:0000269|PubMed:12372286}.

Protein families:


   💬 WhatsApp