CXB2_RAT   P21994


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P21994

Recommended name:Gap junction beta-2 protein

EC number:

Alternative names:

Cleaved into:

GeneID:394266

Gene names  (primary ):Gjb2

Gene names  (synonym ):Cxn-26

Gene names  (ORF ):

Length:226

Mass:26,451

Sequence:MDWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIMVSTPALLVAMHVAYRRHEKKRKFMKGEIKNEFKDIEEIKTQKVRIEGSLWWTYTTSIFFRVIFEAVFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDCFISRPTEKTVFTVFMISVSGICILLNITELCYLFIRYCSGKSKRPV

Tissue specificity:Liver, kidney, intestine, lung, spleen, stomach, testis and brain, but not heart and adult skeletal muscle. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp