HACD1_MOUSE Q9QY80
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QY80
Recommended name：Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1
EC number：EC 4.2.1.134
Alternative names：(3-hydroxyacyl-CoA dehydratase 1) (HACD1) (Protein-tyrosine phosphatase-like member A)
Cleaved into：
GeneID：30963
Gene names (primary )：Hacd1
Gene names (synonym )：Ptpla
Gene names (ORF )：
Length：281
Mass：32327
Sequence：MGKGDWRQGRVEMPCAHVSRLHKTCVQVRVRVTMASSEEDGTNGASEASDEKEAAGKRRRLGLLATAWLTFYNIAMTAGWLVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQTFALLEVVHCLIGIVPTSVLVTGVQVSSRIFMVWLITHSIKPIQNEESVVLFLVSWTVTEITRYSFYTFSLLDHLPHFIKWARYNLFIILYPVGVAGELLTIYAALPYVKKSGMFSVRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVLHGEVIAEKDD
Tissue specificity：Expressed at high levels in heart, skeletal muscle and testis, weak expression in kidney and liver. {ECO:0000269|PubMed:10644438}.
Induction：
Developmental stage：Differentially expressed during embryogenesis. First detected throughout the somites at 8.5 dpc and in the myotome at 11.5 dpc. Expression was observed in muscles ventral to the developing vertebral column of the neck, thorax, abdomen and tail. Expression was maintained in skeletal muscle types well after the terminal differentiation of muscle fibers. During cardiac development, expression was restricted to the myocytes of the primitive heart tube, and by 10.5 dpc, it was expressed in the muscles throughout all the cardiac chambers. At this last stage it is also detected in the hepatic primordia, and later in embryonic liver. By 15.5 expression was also observed in the smooth muscle surrounding the digestive, respiratory and urogenital tracts.
Protein families：Very long-chain fatty acids dehydratase HACD family