GXLT1_RAT   Q6GX83


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6GX83

Recommended name:Glucoside xylosyltransferase 1

EC number:EC:2.4.2.42

Alternative names:Glycosyltransferase 8 domain-containing protein 3 S33-D

Cleaved into:

GeneID:300173

Gene names  (primary ):Gxylt1

Gene names  (synonym ):Glt8d3

Gene names  (ORF ):

Length:435

Mass:50,243

Sequence:MRRYLRVVGLCLACGFCSLLYAFSQLAVSLEEGAAVGRRPQAAVASWLADGGRGTGRGAGSAGPGRTGRCKEVSLSYWNPYWMLPSDVCGVNCFWEAAFRYGLKTRPTEKMHLAVVACGDRLEETVTMLKSALIFSIKPLHVHIFAEDQLHDSFKDRLDSWSFLQRFNYSLYPITFPSDSAMEWKKLFKPCASQRLFLPLILKGVDSLLYVDTDVLFLRPVDDIWSLLERFNSTQIAAMAPEHEEPRVGWYNRFARHPYYGRTGVNSGVMLMNMTRMRRKYFKNDMTTARLQWGDILMPLLKKYKLNITWGDQDLLNIMFYHNPESLFVFPCQWNYRPDHCIYGSNCREAEEEGVFILHGNRGVYHDDKQPAFRAMYEALRNCSLEDDSVRSLLKPLELELQKTVHTYCGKTYKIFIKQLAKSIRNRYDTPPKER

Tissue specificity:By E2F1. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp