SNN_RAT P61808
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61808
Recommended name:Stannin
EC number:
Alternative names:
Cleaved into:
GeneID:29140
Gene names (primary ):Snn
Gene names (synonym ):
Gene names (ORF ):
Length:88
Mass:9,501
Sequence:MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTANSPEVHG
Tissue specificity:High level of expression in spleen, followed by brain and kidney. 1
Induction:
Developmental stage:By trimethyltin (TMT), a trialkyltin compound which is a potent neurotoxic agent that selectively damages specific brain regions. 1
Protein families: