HEY1_MOUSE   Q9WV93


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WV93

Recommended name:Hairy/enhancer-of-split related with YRPW motif protein 1

EC number:

Alternative names:(Hairy and enhancer of split-related protein 1) (HESR-1) (Hairy-related transcription factor 1) (HRT-1) (mHRT1)

Cleaved into:

GeneID:

Gene names  (primary ):Hey1

Gene names  (synonym ):Herp2 Hesr1 Hrt1

Gene names  (ORF ):

Length:299

Mass:32063

Sequence:MKRAHPDYSSSDSELDETIEVEKESADENGNLSSALCSMSPTTSSQVLARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLLVRLVSHLNNYASQREAASGAHGGLGHIPWGSAFGHHPHIAHPLLLPQNGHGNAGTAASPTEPHHQGRLASAHPEAPALRAPPSGGLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFSSFHLLSPSTPTQAANLGKPYRPWGTEIGAF

Tissue specificity:Expressed in somitic mesoderm, brain, central nervous system, kidney, heart, nasal epithelium, limbs, lung, muscle, ovary and testis. {ECO:0000269|PubMed:10860664, ECO:0000269|PubMed:12947105}.

Induction:By activation of the Notch signaling pathway. {ECO:0000269|PubMed:10964718, ECO:0000269|PubMed:11095750, ECO:0000269|PubMed:11486044, ECO:0000269|PubMed:11741889}.

Developmental stage:Expressed in the developing nervous system, the somites, heart and craniofacial region. Expressed in the myocardium of the atrium at 9.5 dpc and in the atrioventricular cushions from 9.5 dpc to 12.5 dpc. Also expressed in developing and adult retina. Expressed in the ventricular zone of the ventral spinal cord at 12 dpc and in the ventricular zone of the telencephalon at 12 dpc and 15 dpc. Weakly expressed in the cortical plate at 15 dpc. {ECO:0000269|PubMed:10415358, ECO:0000269|PubMed:11160397, ECO:0000269|PubMed:12947105, ECO:0000269|PubMed:17259303, ECO:0000269|PubMed:17303760}.

Protein families:HEY family


   💬 WhatsApp