KEG1_RAT   Q9Z2Y0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z2Y0

Recommended name:Glycine N-acyltransferase-like protein Keg1

EC number:EC:2.3.1.13

Alternative names:Acyl-CoA:glycine N-acyltransferase protein Keg1 Hepatocellular carcinoma-enriched protein of 33 kDa (HP33) Kidney-expressed gene 1 protein

Cleaved into:

GeneID:171179

Gene names  (primary ):Keg1

Gene names  (synonym ):Hp33

Gene names  (ORF ):

Length:295

Mass:34,016

Sequence:MFYIQSSEALQILKNSLRKHLPESLKVYGTVFHMNQGNPFKLKAVVDKWPDFNTVVIRPQEQDMTDDLDHYNNTYLIYSKDPKHCQEFLGSSDVINWKQHLQIQSSQADLGKVIENLGATNLGKVKHKQCFLYMVSHTAKKLTPSLVDAKHLVVSSEKPTPFDHQLFKFARLDVKHAALVNSIWYFGGNEKSQKFIERCIFTFPSVCIMGPEGTPVSWALMDHTGELRMAGTLPKYRHQNLIYHVAFHQVHTLEKLGFPMYLHVDKVNLTIQRMSAVLGHVPMPCTWNQWNWVPL

Tissue specificity:Specifically expressed in kidney and liver. Up-regulated in the regenerating liver as well as in hepatocellular carcinoma. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp