NEUR4_MOUSE   Q8BZL1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BZL1

Recommended name:Sialidase-4

EC number:EC 3.2.1.18

Alternative names:(N-acetyl-alpha-neuraminidase 4) (Neuraminidase 4)

Cleaved into:

GeneID:241159

Gene names  (primary ):Neu4

Gene names  (synonym ):

Gene names  (ORF ):

Length:478

Mass:52426

Sequence:MGPTRVPRRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGTLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVLGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGKICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFLAPPSIEPQDDRWTGSPRNTPHSPCFNLRVQESSGEGARGLLERWMPRLPLCYPQSRSPENHGLEPGSDGDKTSWTPECPMSSDSMLQSPTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWVIYEGPSGYSDLAFLGPMPGASLVFACLFESGTRTSYEDISFCLFSLADVLENVPTGLEMLSLRDKAQGHCWPS

Tissue specificity:Highly expressed in brain, particularly in hippocampus, and at lower levels in liver and spleen. Expressed in hippocampal neurons (at protein level). {ECO:0000269|PubMed:14637003, ECO:0000269|PubMed:19506080, ECO:0000269|PubMed:22393058}.

Induction:Down-regulated upon neuron differentiation. {ECO:0000269|PubMed:22393058}.

Developmental stage:Expressed at low levels in embryonic brain, then rapidly up-regulated after birth reaching a maximum at postnatal day 14, followed by a decrease. {ECO:0000269|PubMed:19506080}.

Protein families:Glycosyl hydrolase 33 family


   💬 WhatsApp