TP4A1_MOUSE Q63739
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63739
Recommended name:Protein tyrosine phosphatase type IVA 1
EC number:EC 3.1.3.48
Alternative names:(Protein-tyrosine phosphatase 4a1) (Protein-tyrosine phosphatase of regenerating liver 1) (PRL-1)
Cleaved into:
GeneID:19243
Gene names (primary ):Ptp4a1
Gene names (synonym ):Prl1
Gene names (ORF ):
Length:173
Mass:19815
Sequence:MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Tissue specificity:
Induction:
Developmental stage:Expressed in all tissues except heart and skeletal muscle, from 10.5 dpc to 18.5 dpc. {ECO:0000269|PubMed:10194868}.
Protein families:Protein-tyrosine phosphatase family